PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G68320.1
Common NameAtMYB62, BW62B, BW62C, MYB62, T22E19.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 286aa    MW: 33239.1 Da    PI: 5.8705
Description myb domain protein 62
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G68320.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.2e-172168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll +++   G g+W+ +a++ g++Rt+k+c++rw++yl
      AT1G68320.1 21 RGPWTLEEDTLLTNYILHNGEGRWNHVAKCAGLKRTGKSCRLRWLNYL 68
                     89********************************************97 PP

2Myb_DNA-binding51.91.7e-1674117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      AT1G68320.1  74 RGNLTPQEQLLILELHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0831668IPR017930Myb domain
SuperFamilySSF466893.44E-3019115IPR009057Homeodomain-like
SMARTSM007176.3E-142070IPR001005SANT/Myb domain
PfamPF002492.7E-152168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-222275IPR009057Homeodomain-like
CDDcd001674.35E-102368No hitNo description
PROSITE profilePS5129425.26469123IPR017930Myb domain
SMARTSM007171.4E-1473121IPR001005SANT/Myb domain
PfamPF002491.5E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2376122IPR009057Homeodomain-like
CDDcd001672.08E-1178117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MENSMKKKKS FKESEDEELR RGPWTLEEDT LLTNYILHNG EGRWNHVAKC AGLKRTGKSC  60
RLRWLNYLKP DIRRGNLTPQ EQLLILELHS KWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ  120
KQARQLNIES NSDKFFDAVR SFWVPRLIEK MEQNSSTTTT YCCPQNNNNN SLLLPSQSHD  180
SLSMQKDIDY SGFSNIDGSS STSTCMSHLT TVPHFMDQSN TNIIDGSMCF HEGNVQEFGG  240
YVPGMEDYMV NSDISMECHV ADGYSAYEDV TQDPMWNVDD IWQFRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241812324128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306976590.0
Genevisible260435_at0.0
Expression AtlasAT1G68320-
AtGenExpressAT1G68320-
ATTED-IIAT1G68320-
Functional Description ? help Back to Top
Source Description
TAIRputative transcription factor: R2R3-MYB transcription family. Involved in regulation of phosphate starvation responses and gibberellic acid biosynthesis.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G68320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G68320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195680.0AY519568.1 Arabidopsis thaliana MYB transcription factor (At1g68320) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176999.10.0R2R3-MYB transcription family
SwissprotQ9LDE16e-65MY108_ARATH; Transcription factor MYB108
TrEMBLQ9C9G70.0Q9C9G7_ARATH; MYB transcription factor
STRINGAT1G68320.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  5. Devaiah BN,Madhuvanthi R,Karthikeyan AS,Raghothama KG
    Phosphate starvation responses and gibberellic acid biosynthesis are regulated by the MYB62 transcription factor in Arabidopsis.
    Mol Plant, 2009. 2(1): p. 43-58
    [PMID:19529828]
  6. Romero I, et al.
    More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis thaliana.
    Plant J., 1998. 14(3): p. 273-84
    [PMID:9628022]
  7. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]